Free Shipping (US & Puerto Rico) for all orders over

$300

Sale!

Cagrilintide 10MG

Original price was: $398.59.Current price is: $230.99.

In stock

Free & Fast Shipping

24/7 Support

Earn Rewards

Cagrilintide Overview

Cagrilintide is a potent long-acting acylated amylin analogue that effectively targets amylin receptors (AMYR) and calcitonin G protein-coupled receptors (CTR). It has been shown to induce significant weight loss and reduce food intake, making it a highly promising compound for obesity treatment. In vivo studies have demonstrated Cagrilintide’s efficacy in reducing food intake in animal models, with sustained effects over several days. Currently, Cagrilintide is being used in clinical settings to explore its full potential in addressing obesity and related metabolic conditions.

Product Details

  • Sequence: {Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge:Cys3-Cys8)
  • Sequence Shortening: {Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8)
  • Molecular Formula: C194H312N54O59S2
  • Molecular Weight: 4409.01 g/mol
  • CAS Number: 1415456-99-3

Research Highlights

  1. Weight Loss Efficacy: Cagrilintide has demonstrated significant weight loss potential, reducing food intake in animal studies with sustained effects at doses ranging from 1-10 nmol/kg.
  2. Pharmacokinetics: Cagrilintide exhibits favorable pharmacokinetic properties, delivering effective results when administered subcutaneously or intravenously.
  3. Clinical Application: Cagrilintide is actively used in clinical trials to further assess its efficacy in treating obesity, overweight conditions, and related metabolic disorders.
  4. Obesity Treatment Potential: With its dual mechanism of action, Cagrilintide is positioned as a leading option in the fight against obesity, offering a new and promising approach to weight management.
  • This product is sold for scientific research purposes only.
  • Product is provided as a lyophilized (freeze-dried) powder in a sealed, sterile vial.
  • The quantity on the label refers to the total amount of product inside each vial.
  • Additional lab supplies are required for conducting research such as bacteriostatic water for reconstitution, syringes & needles to draw from the vials, and alcohol prep pads for sanitizing vial stoppers prior to needle insertion.
  • Vial appearance, label, seal and cap colors may vary from product photos.
CAS Number 2023788-19-2
PubChem CID 156588324
Molecular Weight 4813.527 g/mol
Molecular Formula C225H348N48O68
Synonyms GTPL11429, P1206, LY3298176
Storage (Lyophilized) At 39 Fahrenheit: 2 years
At -4 Fahrenheit: 3 years

Related Products

Are you 21 or older?

You must be 21 years old or older in order to access our website. Please verify your age.

0